Skip to main content

Table 1 Proenkephalin and proopiomelanocortin opioid precursors.

From: In Vivo Regulation of the μ Opioid Receptor: Role of the Endogenous Opioid Agents

Precursor Opioid peptides
Proenkephalin (hsa-penk) (1,2) 4 Met-ENK (ME) YGGFM
  1 Leu-ENK (LE) YGGFL
  1 Met-ENK-Arg6-Phe7 (MERF) YGGFMRF
  1 Met-ENK-Arg6-Gly7-Leu8 (MERGL)YGGFMRGL
Proenkephalin b (dre-penk b) (18) 4 Met-ENK (ME) YGGFM
  1 Leu-ENK (LE) YGGFL
  1 Met-ENK-Gly6-Tyr7 (MEGY) YGGFMGY
Proenkephalin a (dre-penk a) (18) 4 Met-ENK (ME) YGGFM
  1 Met-ENK-Ile6 (MEI) YGGFMI
  1 Met-ENK-Asp6 (MED) YGGFMD
Proopiomelanocortin (hsa-pomc) (3) β-END (131) YGGFMTSEKSQTPLVTLFKNAIIKNAYKKGE
Proopiomelanocortin a (dre-pomc a) (19) β-END (132) YGGFMKSWDERAQKPLLTLFKVMHKDQPRKDE
Proopiomelanocortin b (dre-pomc b) (19) β-END (132) YGGLMRPYLDESHKPLITLIRNAIGNGQQFTD
  1. Different opioid peptides that are encoded by the PENK and POMC propeptides in human and zebrafish are shown.